SCOPe 2.06: Domain d3qdjd1: 3qdj D:1-110

Lineage for d3qdjd1 (3qdj D:1-110)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d3qdjd1: 3qdj D:1-110 [200311]
   Other proteins in same PDB: d3qdja1, d3qdja2, d3qdjb1, d3qdjb2, d3qdjd2, d3qdje1, d3qdje2
   automated match to d1qrnd1

Details for d3qdjd1

PDB Entry: 3qdj, 2.3 Å

PDB Description: The complex between TCR DMF5 and human Class I MHC HLA-A2 with the bound MART-1(27-35) nonameric peptide

PDB Compounds: (D:) DMF5 alpha chain

SCOPe Domain Sequences for d3qdjd1:

Sequence; same for both SEQRES and ATOM records:

>d3qdjd1 b.1.1.1 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keveqnsgplsvpegaiaslnctysdrgsqsffwyrqysgkspelimfiysngdkedgrf
taqlnkasqyvsllirdsqpsdsatylcavnfgggklifgqgtelsvkpn

Timeline for d3qdjd1:

• d3qdjd1 first appeared in SCOPe 2.03
  
• d3qdjd1 appears in SCOPe 2.05
  
• d3qdjd1 appears in SCOPe 2.07
  
• d3qdjd1 appears in the current release, SCOPe 2.08