SCOPe 2.04: Domain d3qdge2: 3qdg E:118-245

Lineage for d3qdge2 (3qdg E:118-245)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3qdge2: 3qdg E:118-245 [200308]
   Other proteins in same PDB: d3qdga1, d3qdga2, d3qdgb_, d3qdgd1, d3qdge1
   automated match to d1qsee2

Details for d3qdge2

PDB Entry: 3qdg, 2.69 Å

PDB Description: The complex between TCR DMF5 and human Class I MHC HLA-A2 with the bound MART-1(26-35)(A27L) peptide

PDB Compounds: (E:) DMF5 beta chain

SCOPe Domain Sequences for d3qdge2:

Sequence; same for both SEQRES and ATOM records:

>d3qdge2 b.1.1.2 (E:118-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnkvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Timeline for d3qdge2:

• d3qdge2 first appeared in SCOPe 2.03
  
• d3qdge2 appears in SCOPe 2.05
  
• d3qdge2 appears in the current release, SCOPe 2.08