Class g: Small proteins [56992] (92 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein BMP receptor Ia ectodomain [57359] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries) |
Domain d3qb4b_: 3qb4 B: [200296] Other proteins in same PDB: d3qb4a_, d3qb4c_ automated match to d1rewd_ |
PDB Entry: 3qb4 (more details), 2.28 Å
SCOPe Domain Sequences for d3qb4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qb4b_ g.7.1.3 (B:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} dtlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckds pkaqlrrtieccrtnlcnqylqptlppv
Timeline for d3qb4b_: