Lineage for d1rmfh1 (1rmf H:1-119)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158361Species Fab R6.5 (mouse), kappa L chain [48796] (1 PDB entry)
  8. 158362Domain d1rmfh1: 1rmf H:1-119 [20029]
    Other proteins in same PDB: d1rmfh2, d1rmfl2

Details for d1rmfh1

PDB Entry: 1rmf (more details), 2.8 Å

PDB Description: structures of a monoclonal anti-icam-1 antibody r6.5 fragment at 2.8 angstroms resolution

SCOP Domain Sequences for d1rmfh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmfh1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab R6.5 (mouse), kappa L chain}
qvqlqqsgpelvrpgvsvkisckgsgytfidyaihwvkeshakslewigvisaysgdtny
nqkfkgkatmtvdkssntaylelarltsedsaiyycarggwlllsfdywgqgttltvss

SCOP Domain Coordinates for d1rmfh1:

Click to download the PDB-style file with coordinates for d1rmfh1.
(The format of our PDB-style files is described here.)

Timeline for d1rmfh1:

Domains from same chain:
(mouse over for more information)
d1rmfh2
Domains from other chains:
(mouse over for more information)
d1rmfl1, d1rmfl2