Lineage for d3pwpe2 (3pwp E:118-246)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362261Domain d3pwpe2: 3pwp E:118-246 [200272]
    Other proteins in same PDB: d3pwpa1, d3pwpa2, d3pwpb1, d3pwpb2, d3pwpd1, d3pwpd2, d3pwpe1
    automated match to d1ktke2
    complexed with gol, so4

Details for d3pwpe2

PDB Entry: 3pwp (more details), 2.69 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the bound HuD peptide
PDB Compounds: (E:) A6 TCR beta chain

SCOPe Domain Sequences for d3pwpe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwpe2 b.1.1.2 (E:118-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3pwpe2:

Click to download the PDB-style file with coordinates for d3pwpe2.
(The format of our PDB-style files is described here.)

Timeline for d3pwpe2: