Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d3pwpe1: 3pwp E:1-117 [200271] Other proteins in same PDB: d3pwpa1, d3pwpa2, d3pwpb1, d3pwpb2, d3pwpd1, d3pwpd2, d3pwpe2 automated match to d1ktke1 complexed with gol, so4 |
PDB Entry: 3pwp (more details), 2.69 Å
SCOPe Domain Sequences for d3pwpe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwpe1 b.1.1.0 (E:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]} nagvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgev pngynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvte
Timeline for d3pwpe1: