SCOPe 2.04: Domain d3pwpd2: 3pwp D:118-206

Lineage for d3pwpd2 (3pwp D:118-206)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries)

8. Domain d3pwpd2: 3pwp D:118-206 [200270]
   Other proteins in same PDB: d3pwpa1, d3pwpa2, d3pwpb_, d3pwpd1, d3pwpe1, d3pwpe2
   automated match to d1qsed2
   complexed with gol, so4

Details for d3pwpd2

PDB Entry: 3pwp, 2.69 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the bound HuD peptide

PDB Compounds: (D:) A6 TCR alpha chain

SCOPe Domain Sequences for d3pwpd2:

Sequence; same for both SEQRES and ATOM records:

>d3pwpd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d3pwpd2:

• d3pwpd2 first appeared in SCOPe 2.03
  
• d3pwpd2 appears in SCOPe 2.05
  
• d3pwpd2 appears in the current release, SCOPe 2.08