Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries) |
Domain d3pwpd2: 3pwp D:118-206 [200270] Other proteins in same PDB: d3pwpa1, d3pwpa2, d3pwpb_, d3pwpd1, d3pwpe1, d3pwpe2 automated match to d1qsed2 complexed with gol, so4 |
PDB Entry: 3pwp (more details), 2.69 Å
SCOPe Domain Sequences for d3pwpd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwpd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d3pwpd2: