Lineage for d1fbiq1 (1fbi Q:1-121)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158181Species Fab F9.13.7 (mouse), kappa L chain [48795] (1 PDB entry)
  8. 158185Domain d1fbiq1: 1fbi Q:1-121 [20027]
    Other proteins in same PDB: d1fbih2, d1fbil2, d1fbip2, d1fbiq2, d1fbix_, d1fbiy_

Details for d1fbiq1

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbiq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbiq1 b.1.1.1 (Q:1-121) Immunoglobulin (variable domains of L and H chains) {Fab F9.13.7 (mouse), kappa L chain}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqgpgqglewigeidpsdsypny
nekfkgkatltvdkssstaymqlssltsedsavyycaslyyygtsygvldywgqgtsvtv
s

SCOP Domain Coordinates for d1fbiq1:

Click to download the PDB-style file with coordinates for d1fbiq1.
(The format of our PDB-style files is described here.)

Timeline for d1fbiq1: