Lineage for d3pwpa1 (3pwp A:1-181)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1641840Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1641866Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
    Uniprot P01892 25-298
  8. 1641982Domain d3pwpa1: 3pwp A:1-181 [200267]
    Other proteins in same PDB: d3pwpa2, d3pwpb_, d3pwpd1, d3pwpd2, d3pwpe1, d3pwpe2
    automated match to d1i4fa2
    complexed with gol, so4

Details for d3pwpa1

PDB Entry: 3pwp (more details), 2.69 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the bound HuD peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3pwpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwpa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3pwpa1:

Click to download the PDB-style file with coordinates for d3pwpa1.
(The format of our PDB-style files is described here.)

Timeline for d3pwpa1: