Lineage for d3pwld1 (3pwl D:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2544763Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
    Uniprot P01892 25-298
  8. 2544769Domain d3pwld1: 3pwl D:1-181 [200261]
    Other proteins in same PDB: d3pwla2, d3pwlb1, d3pwlb2, d3pwld2, d3pwle1, d3pwle2
    automated match to d1i4fa2
    complexed with gol

Details for d3pwld1

PDB Entry: 3pwl (more details), 1.65 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the HuD peptide
PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3pwld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwld1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3pwld1:

Click to download the PDB-style file with coordinates for d3pwld1.
(The format of our PDB-style files is described here.)

Timeline for d3pwld1: