Lineage for d1fbip1 (1fbi P:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653692Domain d1fbip1: 1fbi P:1-107 [20026]
    Other proteins in same PDB: d1fbih1, d1fbih2, d1fbil2, d1fbip2, d1fbiq1, d1fbiq2, d1fbix_, d1fbiy_
    part of Fab F9.13.7

Details for d1fbip1

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme
PDB Compounds: (P:) igg1 f9.13.7 fab (light chain)

SCOP Domain Sequences for d1fbip1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbip1 b.1.1.1 (P:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqkkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltirnleqediatyfcqqgytlpytfgggtkleik

SCOP Domain Coordinates for d1fbip1:

Click to download the PDB-style file with coordinates for d1fbip1.
(The format of our PDB-style files is described here.)

Timeline for d1fbip1: