SCOP 1.57: Domain d1fbip1: 1fbi P:1-107

Lineage for d1fbip1 (1fbi P:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab F9.13.7 (mouse), kappa L chain [48795] (1 PDB entry)

8. Domain d1fbip1: 1fbi P:1-107 [20026]
   Other proteins in same PDB: d1fbih2, d1fbil2, d1fbip2, d1fbiq2, d1fbix_, d1fbiy_

Details for d1fbip1

PDB Entry: 1fbi, 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbip1:

Sequence; same for both SEQRES and ATOM records:

>d1fbip1 b.1.1.1 (P:1-107) Immunoglobulin (variable domains of L and H chains) {Fab F9.13.7 (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqkkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltirnleqediatyfcqqgytlpytfgggtkleik

Timeline for d1fbip1:

• d1fbip1 first appeared (with stable ids) in SCOP 1.55
  
• d1fbip1 appears in SCOP 1.59
  
• d1fbip1 appears in the current release, SCOPe 2.08