Lineage for d1fbih1 (1fbi H:1-121)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7680Species Fab F9.13.7 (mouse), kappa L chain [48795] (1 PDB entry)
  8. 7681Domain d1fbih1: 1fbi H:1-121 [20025]
    Other proteins in same PDB: d1fbih2, d1fbil2, d1fbip2, d1fbiq2, d1fbix_, d1fbiy_

Details for d1fbih1

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

SCOP Domain Sequences for d1fbih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbih1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab F9.13.7 (mouse), kappa L chain}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqgpgqglewigeidpsdsypny
nekfkgkatltvdkssstaymqlssltsedsavyycaslyyygtsygvldywgqgtsvtv
s

SCOP Domain Coordinates for d1fbih1:

Click to download the PDB-style file with coordinates for d1fbih1.
(The format of our PDB-style files is described here.)

Timeline for d1fbih1: