SCOPe 2.03: Domain d1fbil1: 1fbi L:1-107

Lineage for d1fbil1 (1fbi L:1-107)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (213 PDB entries)
Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor

Domain d1fbil1: 1fbi L:1-107 [20024]
Other proteins in same PDB: d1fbih1, d1fbih2, d1fbil2, d1fbip2, d1fbiq1, d1fbiq2, d1fbix_, d1fbiy_
part of Fab F9.13.7

Details for d1fbil1

PDB Entry: 1fbi (more details), 3 Å

PDB Description: crystal structure of a cross-reaction complex between fab f9.13.7 and guinea-fowl lysozyme

PDB Compounds: (L:) igg1 f9.13.7 fab (light chain)

SCOPe Domain Sequences for d1fbil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbil1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqkkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltirnleqediatyfcqqgytlpytfgggtkleik

SCOPe Domain Coordinates for d1fbil1:

Click to download the PDB-style file with coordinates for d1fbil1.
(The format of our PDB-style files is described here.)

Timeline for d1fbil1: