Lineage for d1mrch1 (1mrc H:1-115)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219817Species Fab Jel 103 (mouse), kappa L chain [48794] (4 PDB entries)
  8. 219824Domain d1mrch1: 1mrc H:1-115 [20023]
    Other proteins in same PDB: d1mrch2, d1mrcl2
    complexed with imd, so4, zn

Details for d1mrch1

PDB Entry: 1mrc (more details), 2.4 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrch1:

Sequence, based on SEQRES records: (download)

>d1mrch1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
nqkfkgkatltvdtssstaymqlssltsedsavyycanlrgyfdywgqgttltvssak

Sequence, based on observed residues (ATOM records): (download)

>d1mrch1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeisytnynqkf
kgkatltvdstaymqlssltsedsavyycanlrgyfdywgqgttltvssak

SCOP Domain Coordinates for d1mrch1:

Click to download the PDB-style file with coordinates for d1mrch1.
(The format of our PDB-style files is described here.)

Timeline for d1mrch1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mrch2