SCOP 1.73: Domain d1mrcl1: 1mrc L:1-108

Lineage for d1mrcl1 (1mrc L:1-108)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1mrcl1: 1mrc L:1-108 [20022]
   Other proteins in same PDB: d1mrch1, d1mrch2, d1mrcl2
   part of Fab Jel 103
   complexed with imd, so4, zn

Details for d1mrcl1

PDB Entry: 1mrc, 2.4 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

PDB Compounds: (L:) igg2b-kappa jel103 fab (light chain)

SCOP Domain Sequences for d1mrcl1:

Sequence; same for both SEQRES and ATOM records:

>d1mrcl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikr

Timeline for d1mrcl1:

• d1mrcl1 first appeared (with stable ids) in SCOP 1.55
  
• d1mrcl1 appears in SCOP 1.71
  
• d1mrcl1 appears in SCOP 1.75
  
• d1mrcl1 appears in the current release, SCOPe 2.08