Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.0: automated matches [227271] (1 protein) not a true family |
Protein automated matches [227074] (6 species) not a true protein |
Species Methanothermobacter marburgensis [TaxId:145263] [226795] (1 PDB entry) |
Domain d3pota1: 3pot A:2-269 [200216] Other proteins in same PDB: d3pota2, d3potb2, d3potc_, d3potd2, d3pote2, d3potf_ automated match to d1e6va2 complexed with 06c, com, edo, f43, k, mg, tp7, txz |
PDB Entry: 3pot (more details), 1.2 Å
SCOPe Domain Sequences for d3pota1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pota1 d.58.31.0 (A:2-269) automated matches {Methanothermobacter marburgensis [TaxId: 145263]} adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq aageaatgdfayaakhaevihmgtylpv
Timeline for d3pota1: