Lineage for d3p77a2 (3p77 A:178-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754070Domain d3p77a2: 3p77 A:178-273 [200204]
    Other proteins in same PDB: d3p77a1
    automated match to d1de4a1
    complexed with 2pe, act, pge

Details for d3p77a2

PDB Entry: 3p77 (more details), 1.6 Å

PDB Description: Crystal Structures of the Chicken YF1*7.1 molecule
PDB Compounds: (A:) MHC Rfp-Y class I alpha chain

SCOPe Domain Sequences for d3p77a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p77a2 b.1.1.0 (A:178-273) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rrvqpevrvwgkeadgiltlschahgfyprpitiswmkdgmvrdqetrwggivpnsdgty
hasaaidvlpedgdkywcrvehaslpqpglfswepq

SCOPe Domain Coordinates for d3p77a2:

Click to download the PDB-style file with coordinates for d3p77a2.
(The format of our PDB-style files is described here.)

Timeline for d3p77a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p77a1
View in 3D
Domains from other chains:
(mouse over for more information)
d3p77b_