Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries) |
Domain d3p77a1: 3p77 A:0-177 [200203] Other proteins in same PDB: d3p77a2, d3p77b_ automated match to d1de4a2 complexed with 2pe, act, pge |
PDB Entry: 3p77 (more details), 1.6 Å
SCOPe Domain Sequences for d3p77a1:
Sequence, based on SEQRES records: (download)
>d3p77a1 d.19.1.0 (A:0-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} fgshslryfltgmtdpgpgmprfvivgyvddkifgtynsksrtaqpivemlpqedqehwd tqtqkaqggerdfdwnlnrlperynkskgshtmqmmfgcdiledgsirgydqyafdgrdf lafdmdtmtftaadpvaeitkrrwetegtyaerwkhelgtvcvqnlrrylehgkaalk
>d3p77a1 d.19.1.0 (A:0-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} fgshslryfltgmtdpgpgmprfvivgyvddkifgtynsksrtaqpivemlpqedqehwd tqtqkaqggerdfdwnlnrlperynkgshtmqmmfgcdiledgsirgydqyafdgrdfla fdmdtmtftaadpvaeitkrrwetegtyaerwkhelgtvcvqnlrrylehgkaalk
Timeline for d3p77a1: