Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [188287] (13 PDB entries) |
Domain d3p73a2: 3p73 A:178-273 [200202] Other proteins in same PDB: d3p73a1 automated match to d1de4a1 complexed with 16a, act |
PDB Entry: 3p73 (more details), 1.32 Å
SCOPe Domain Sequences for d3p73a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p73a2 b.1.1.0 (A:178-273) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} rrvqpevrvwgkeadgiltlschahgfyprpitiswmkdgmvrdqetrwggivpnsdgty hasaaidvlpedgdkywcrvehaslpqpglfswepq
Timeline for d3p73a2: