SCOPe 2.07: Domain d3p73a1: 3p73 A:-1-177

Lineage for d3p73a1 (3p73 A:-1-177)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225828] (13 PDB entries)

8. Domain d3p73a1: 3p73 A:-1-177 [200201]
   Other proteins in same PDB: d3p73a2, d3p73b_
   automated match to d1de4a2
   complexed with 16a, act

Details for d3p73a1

PDB Entry: 3p73, 1.32 Å

PDB Description: Crystal Structures of the Chicken YF1*7.1 molecule

PDB Compounds: (A:) MHC Rfp-Y class I alpha chain

SCOPe Domain Sequences for d3p73a1:

Sequence; same for both SEQRES and ATOM records:

>d3p73a1 d.19.1.0 (A:-1-177) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
efgshslryfltgmtdpgpgmprfvivgyvddkifgtynsksrtaqpivemlpqedqehw
dtqtqkaqggerdfdwnlnrlperynkskgshtmqmmfgcdiledgsirgydqyafdgrd
flafdmdtmtftaadpvaeitkrrwetegtyaerwkhelgtvcvqnlrrylehgkaalk

Timeline for d3p73a1:

• d3p73a1 first appeared in SCOPe 2.03
  
• d3p73a1 appears in SCOPe 2.06
  
• d3p73a1 appears in the current release, SCOPe 2.08