SCOPe 2.07: Domain d3p19a_: 3p19 A:

Lineage for d3p19a_ (3p19 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:672] [196316] (1 PDB entry)

8. Domain d3p19a_: 3p19 A: [200188]
   automated match to d3p19d_
   complexed with ndp

Details for d3p19a_

PDB Entry: 3p19, 2.05 Å

PDB Description: Improved NADPH-dependent Blue Fluorescent Protein

PDB Compounds: (A:) Putative blue fluorescent protein

SCOPe Domain Sequences for d3p19a_:

Sequence; same for both SEQRES and ATOM records:

>d3p19a_ c.2.1.0 (A:) automated matches {Vibrio vulnificus [TaxId: 672]}
mkklvvitgassgigeaiarrfseeghpllllarrverlkalnlpntlcaqvdvtdkytf
dtaitraekiygpadaivnnagmmllgqidtqeanewqrmfdvnvlgllngmqavlapmk
arncgtiinissiagkktfpdhaaycgtkfavhaisenvreevaasnvrvmtiapsavkt
ellshttsqqikdgydawrvdmggvlaaddvaravlfayqqpqnvcireialaptkqqp

Timeline for d3p19a_:

• d3p19a_ first appeared in SCOPe 2.03
  
• d3p19a_ appears in SCOPe 2.06
  
• d3p19a_ appears in the current release, SCOPe 2.08, called d3p19a1