Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Vibrio vulnificus [TaxId:672] [196316] (1 PDB entry) |
Domain d3p19a_: 3p19 A: [200188] automated match to d3p19d_ complexed with ndp |
PDB Entry: 3p19 (more details), 2.05 Å
SCOPe Domain Sequences for d3p19a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p19a_ c.2.1.0 (A:) automated matches {Vibrio vulnificus [TaxId: 672]} mkklvvitgassgigeaiarrfseeghpllllarrverlkalnlpntlcaqvdvtdkytf dtaitraekiygpadaivnnagmmllgqidtqeanewqrmfdvnvlgllngmqavlapmk arncgtiinissiagkktfpdhaaycgtkfavhaisenvreevaasnvrvmtiapsavkt ellshttsqqikdgydawrvdmggvlaaddvaravlfayqqpqnvcireialaptkqqp
Timeline for d3p19a_: