SCOPe 2.03: Domain d3owep1: 3owe P:1-115

Lineage for d3owep1 (3owe P:1-115)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (4 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225054] (6 PDB entries)

8. Domain d3owep1: 3owe P:1-115 [200179]
   Other proteins in same PDB: d3owea_, d3oweb2, d3owec_, d3owed2, d3owee_, d3owef2, d3oweg_, d3oweh2, d3owei_, d3owej2, d3owek_, d3owel2, d3owem_, d3owen2, d3oweo_, d3owep2
   automated match to d1d5zc1
   mutant

Details for d3owep1

PDB Entry: 3owe, 2.6 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain

PDB Compounds: (P:) Enterotoxin SEG

SCOPe Domain Sequences for d3owep1:

Sequence, based on SEQRES records:

>d3owep1 b.40.2.0 (P:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
nevktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltf

Sequence, based on observed residues (ATOM records):

>d3owep1 b.40.2.0 (P:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
aqpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksy
nevktelentelannykgkkvdifgvpyfytciipksefggccmyggltf

Timeline for d3owep1:

• d3owep1 is new in SCOPe 2.03-stable
  
• d3owep1 appears in SCOPe 2.04
  
• d3owep1 appears in the current release, SCOPe 2.08