SCOPe 2.07: Domain d3owef1: 3owe F:2-115

Lineage for d3owef1 (3owe F:2-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225054] (10 PDB entries)

8. Domain d3owef1: 3owe F:2-115 [200169]
   Other proteins in same PDB: d3owea_, d3oweb2, d3oweb3, d3owec_, d3owed2, d3owed3, d3owee_, d3owef2, d3owef3, d3oweg_, d3oweh2, d3oweh3, d3owei_, d3owej2, d3owej3, d3owek_, d3owel2, d3owel3, d3owem_, d3owen2, d3owen3, d3oweo_, d3owep2, d3owep3
   automated match to d1d5zc1
   mutant

Details for d3owef1

PDB Entry: 3owe, 2.6 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G (SEG) in Complex with a High Affinity Mutant Mouse T-cell Receptor Chain

PDB Compounds: (F:) Enterotoxin SEG

SCOPe Domain Sequences for d3owef1:

Sequence, based on SEQRES records:

>d3owef1 b.40.2.0 (F:2-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
evktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltf

Sequence, based on observed residues (ATOM records):

>d3owef1 b.40.2.0 (F:2-115) automated matches {Staphylococcus aureus [TaxId: 1280]}
qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn
evktelentelannykgkkvdifgvpyfytciipksefggccmyggltf

Timeline for d3owef1:

• d3owef1 first appeared in SCOPe 2.03
  
• d3owef1 appears in SCOPe 2.06
  
• d3owef1 appears in the current release, SCOPe 2.08