Lineage for d3otwd_ (3otw D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860956Species Helicobacter pylori [TaxId:85962] [193641] (2 PDB entries)
  8. 2860961Domain d3otwd_: 3otw D: [200161]
    automated match to d3otwf_
    complexed with coa, so4

Details for d3otwd_

PDB Entry: 3otw (more details), 1.8 Å

PDB Description: Structural and Functional Studies of Helicobacter pylori Wild-Type and Mutated Proteins Phosphopantetheine adenylyltransferase
PDB Compounds: (D:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3otwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3otwd_ c.26.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]}
mqkigiypgtfdpvtnghidiihrsselfeklivavahssaknpmfslderlkmiqlatk
sfknvecvafegllanlakeyhckvlvrglrvvsdfeyelqmgyankslnheletlyfmp
tlqnafisssivrsiiahkgdashlvpkeiyplisk

SCOPe Domain Coordinates for d3otwd_:

Click to download the PDB-style file with coordinates for d3otwd_.
(The format of our PDB-style files is described here.)

Timeline for d3otwd_: