Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (61 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [193641] (2 PDB entries) |
Domain d3otwd_: 3otw D: [200161] automated match to d3otwf_ complexed with coa, so4 |
PDB Entry: 3otw (more details), 1.8 Å
SCOPe Domain Sequences for d3otwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3otwd_ c.26.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 85962]} mqkigiypgtfdpvtnghidiihrsselfeklivavahssaknpmfslderlkmiqlatk sfknvecvafegllanlakeyhckvlvrglrvvsdfeyelqmgyankslnheletlyfmp tlqnafisssivrsiiahkgdashlvpkeiyplisk
Timeline for d3otwd_: