SCOP 1.55: Domain d1mrdl1: 1mrd L:1-108

Lineage for d1mrdl1 (1mrd L:1-108)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab Jel 103 (mouse), kappa L chain [48794] (4 PDB entries)

8. Domain d1mrdl1: 1mrd L:1-108 [20016]
   Other proteins in same PDB: d1mrdh2, d1mrdl2

Details for d1mrdl1

PDB Entry: 1mrd, 2.3 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

SCOP Domain Sequences for d1mrdl1:

Sequence; same for both SEQRES and ATOM records:

>d1mrdl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab Jel 103 (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikr

Timeline for d1mrdl1:

• d1mrdl1 appears in SCOP 1.57
  
• d1mrdl1 appears in the current release, SCOPe 2.08