Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries) |
Domain d1eapb1: 1eap B:1-124 [20015] Other proteins in same PDB: d1eapa1, d1eapa2, d1eapb2 part of Fab 17E8 |
PDB Entry: 1eap (more details), 2.5 Å
SCOP Domain Sequences for d1eapb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2} evqlqesgtelvkpgasvkisckasgyistdhaihwvkqrpeqglewigyispgngdiky nekfkvkatltadqssstaymqlnsltsedsavyfckrsyygssyvdywgqgttltvss
Timeline for d1eapb1: