Lineage for d1eapa1 (1eap A:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7356Species Fab 17E8 (mouse), kappa L chain [48793] (1 PDB entry)
  8. 7357Domain d1eapa1: 1eap A:1-107 [20014]
    Other proteins in same PDB: d1eapa2, d1eapb2

Details for d1eapa1

PDB Entry: 1eap (more details), 2.5 Å

PDB Description: crystal structure of a catalytic antibody with a serine protease active site

SCOP Domain Sequences for d1eapa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eapa1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 17E8 (mouse), kappa L chain}
dieltqspsslsaslggkvtitckasqdikkyigwyqhkpgkgprllihytstllpgips
rfrgsgsgrdysfsisnleggdiatyyclqyynlrtfgggtkleik

SCOP Domain Coordinates for d1eapa1:

Click to download the PDB-style file with coordinates for d1eapa1.
(The format of our PDB-style files is described here.)

Timeline for d1eapa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eapa2