Lineage for d3opvf_ (3opv F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2887952Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2888013Species Escherichia coli [TaxId:562] [53172] (30 PDB entries)
  8. 2888052Domain d3opvf_: 3opv F: [200127]
    automated match to d3opvl_
    complexed with po4; mutant

Details for d3opvf_

PDB Entry: 3opv (more details), 2.4 Å

PDB Description: Crystal structure of E. Coli purine nucleoside phosphorylase Arg24Ala mutant
PDB Compounds: (F:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d3opvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3opvf_ c.56.2.1 (F:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]}
atphinaemgdfadvvlmpgdplaakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

SCOPe Domain Coordinates for d3opvf_:

Click to download the PDB-style file with coordinates for d3opvf_.
(The format of our PDB-style files is described here.)

Timeline for d3opvf_: