SCOP 1.65: Domain d1knoe1: 1kno E:1-108

Lineage for d1knoe1 (1kno E:1-108)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
Domain d1knoe1: 1kno E:1-108 [20012]
Other proteins in same PDB: d1knoa2, d1knob1, d1knob2, d1knoc2, d1knod1, d1knod2, d1knoe2, d1knof1, d1knof2
part of Fab CNJ206
complexed with pnp, zn

Details for d1knoe1

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knoe1 b.1.1.1 (E:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilr

SCOP Domain Coordinates for d1knoe1:

Click to download the PDB-style file with coordinates for d1knoe1.
(The format of our PDB-style files is described here.)

Timeline for d1knoe1: