Lineage for d1knod1 (1kno D:1-119)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782083Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (54 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 782139Domain d1knod1: 1kno D:1-119 [20011]
    Other proteins in same PDB: d1knoa1, d1knoa2, d1knob2, d1knoc1, d1knoc2, d1knod2, d1knoe1, d1knoe2, d1knof2
    part of Fab CNJ206

Details for d1knod1

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes
PDB Compounds: (D:) igg2a fab fragment cnj206

SCOP Domain Sequences for d1knod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knod1 b.1.1.1 (D:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsa

SCOP Domain Coordinates for d1knod1:

Click to download the PDB-style file with coordinates for d1knod1.
(The format of our PDB-style files is described here.)

Timeline for d1knod1: