SCOP 1.61: Domain d1knod1: 1kno D:1-119

Lineage for d1knod1 (1kno D:1-119)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries)
Domain d1knod1: 1kno D:1-119 [20011]
Other proteins in same PDB: d1knoa2, d1knob2, d1knoc2, d1knod2, d1knoe2, d1knof2

Details for d1knod1

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knod1 b.1.1.1 (D:1-119) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsa

SCOP Domain Coordinates for d1knod1:

Click to download the PDB-style file with coordinates for d1knod1.
(The format of our PDB-style files is described here.)

Timeline for d1knod1: