SCOPe 2.07: Domain d3oj2d2: 3oj2 D:251-359

Lineage for d3oj2d2 (3oj2 D:251-359)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3oj2d2: 3oj2 D:251-359 [200094]
   Other proteins in same PDB: d3oj2a_, d3oj2b_, d3oj2c1, d3oj2d1
   automated match to d1ev2g2
   complexed with so4; mutant

Details for d3oj2d2

PDB Entry: 3oj2, 2.2 Å

PDB Description: Crystal structure of FGF1 complexed with the ectodomain of FGFR2b harboring the A172F Pfeiffer syndrome mutation

PDB Compounds: (D:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3oj2d2:

Sequence; same for both SEQRES and ATOM records:

>d3oj2d2 b.1.1.0 (D:251-359) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsphrpilqaglpanastvvggdvefvckvysdaqphiqwikhvekngskygpdglpylk
vlkhsginssnaevlalfnvteadageyickvsnyigqanqsawltvlp

Timeline for d3oj2d2:

• d3oj2d2 first appeared in SCOPe 2.03
  
• d3oj2d2 appears in SCOPe 2.06
  
• d3oj2d2 appears in the current release, SCOPe 2.08