Lineage for d3oj2c1 (3oj2 C:151-250)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295367Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1295762Protein automated matches [190803] (1 species)
    not a true protein
  7. 1295763Species Human (Homo sapiens) [TaxId:9606] [188070] (21 PDB entries)
  8. 1295788Domain d3oj2c1: 3oj2 C:151-250 [200091]
    Other proteins in same PDB: d3oj2a_, d3oj2b_, d3oj2c2, d3oj2d2
    automated match to d1ev2g1
    complexed with so4; mutant

Details for d3oj2c1

PDB Entry: 3oj2 (more details), 2.2 Å

PDB Description: Crystal structure of FGF1 complexed with the ectodomain of FGFR2b harboring the A172F Pfeiffer syndrome mutation
PDB Compounds: (C:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d3oj2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oj2c1 b.1.1.4 (C:151-250) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krapywtntekmekrlhavpafntvkfrcpaggnpmptmrwlkngkefkqehriggykvr
nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOPe Domain Coordinates for d3oj2c1:

Click to download the PDB-style file with coordinates for d3oj2c1.
(The format of our PDB-style files is described here.)

Timeline for d3oj2c1:

1295788
d3oj2c1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3oj2c2