SCOP 1.63: Domain d1knob1: 1kno B:1-119

Lineage for d1knob1 (1kno B:1-119)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries)
Domain d1knob1: 1kno B:1-119 [20009]
Other proteins in same PDB: d1knoa2, d1knob2, d1knoc2, d1knod2, d1knoe2, d1knof2

Details for d1knob1

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knob1 b.1.1.1 (B:1-119) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsa

SCOP Domain Coordinates for d1knob1:

Click to download the PDB-style file with coordinates for d1knob1.
(The format of our PDB-style files is described here.)

Timeline for d1knob1: