Lineage for d1knob1 (1kno B:1-119)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102573Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries)
  8. 102575Domain d1knob1: 1kno B:1-119 [20009]
    Other proteins in same PDB: d1knoa2, d1knob2, d1knoc2, d1knod2, d1knoe2, d1knof2

Details for d1knob1

PDB Entry: 1kno (more details), 3.2 Å

PDB Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes

SCOP Domain Sequences for d1knob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1knob1 b.1.1.1 (B:1-119) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsa

SCOP Domain Coordinates for d1knob1:

Click to download the PDB-style file with coordinates for d1knob1.
(The format of our PDB-style files is described here.)

Timeline for d1knob1: