Lineage for d3oeve_ (3oev E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2550690Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2550699Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (199 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2551141Domain d3oeve_: 3oev E: [200069]
    Other proteins in same PDB: d3oevb_, d3oevd_, d3oevf_, d3oevp_, d3oevr_, d3oevt_
    automated match to d1jd2z_
    complexed with 3oe, mes, mg

Details for d3oeve_

PDB Entry: 3oev (more details), 2.85 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 25
PDB Compounds: (E:) Proteasome component PRE5

SCOPe Domain Sequences for d3oeve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeve_ d.153.1.4 (E:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d3oeve_:

Click to download the PDB-style file with coordinates for d3oeve_.
(The format of our PDB-style files is described here.)

Timeline for d3oeve_: