Lineage for d3oevd_ (3oev D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2993452Domain d3oevd_: 3oev D: [200068]
    Other proteins in same PDB: d3oev1_, d3oev2_, d3oeva_, d3oevc_, d3oeve_, d3oevf_, d3oevg_, d3oevh_, d3oevi_, d3oevj_, d3oevk_, d3oevl_, d3oevm_, d3oevn_, d3oevo_, d3oevq_, d3oevs_, d3oevt_, d3oevu_, d3oevv_, d3oevw_, d3oevx_, d3oevy_, d3oevz_
    automated match to d3bdmd_
    complexed with 3oe, mes, mg

Details for d3oevd_

PDB Entry: 3oev (more details), 2.85 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 25
PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d3oevd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oevd_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3oevd_:

Click to download the PDB-style file with coordinates for d3oevd_.
(The format of our PDB-style files is described here.)

Timeline for d3oevd_: