SCOP 1.55: Domain d2gfbo1: 2gfb O:1-108

Lineage for d2gfbo1 (2gfb O:1-108)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries)

8. Domain d2gfbo1: 2gfb O:1-108 [20006]
   Other proteins in same PDB: d2gfba2, d2gfbb2, d2gfbc2, d2gfbd2, d2gfbe2, d2gfbf2, d2gfbg2, d2gfbh2, d2gfbi2, d2gfbj2, d2gfbk2, d2gfbl2, d2gfbm2, d2gfbn2, d2gfbo2, d2gfbp2

Details for d2gfbo1

PDB Entry: 2gfb, 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbo1:

Sequence; same for both SEQRES and ATOM records:

>d2gfbo1 b.1.1.1 (O:1-108) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilr

Timeline for d2gfbo1:

• d2gfbo1 appears in SCOP 1.57
  
• d2gfbo1 appears in the current release, SCOPe 2.08