SCOPe 2.08: Domain d3oeus_: 3oeu S:

Lineage for d3oeus_ (3oeu S:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3oeus_: 3oeu S: [200059]
   Other proteins in same PDB: d3oeub_, d3oeud_, d3oeuf_, d3oeup_, d3oeur_, d3oeut_
   automated match to d1jd2z_
   complexed with mes, mg, oeu

Details for d3oeus_

PDB Entry: 3oeu, 2.6 Å

PDB Description: Structure of yeast 20S open-gate proteasome with Compound 24

PDB Compounds: (S:) Proteasome component PRE5

SCOPe Domain Sequences for d3oeus_:

Sequence; same for both SEQRES and ATOM records:

>d3oeus_ d.153.1.4 (S:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

Timeline for d3oeus_:

• d3oeus_ first appeared in SCOPe 2.03
  
• d3oeus_ appears in SCOPe 2.07