| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab CNJ206 (mouse), kappa L chain [48792] (2 PDB entries) |
| Domain d2gfbl1: 2gfb L:1-119 [20003] Other proteins in same PDB: d2gfba2, d2gfbb2, d2gfbc2, d2gfbd2, d2gfbe2, d2gfbf2, d2gfbg2, d2gfbh2, d2gfbi2, d2gfbj2, d2gfbk2, d2gfbl2, d2gfbm2, d2gfbn2, d2gfbo2, d2gfbp2 |
PDB Entry: 2gfb (more details), 3 Å
SCOP Domain Sequences for d2gfbl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbl1 b.1.1.1 (L:1-119) Immunoglobulin (variable domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
ttap
Timeline for d2gfbl1:
View in 3DDomains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp1, d2gfbp2 |