Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries) |
Domain d3o9wd1: 3o9w D:2-112 [200029] Other proteins in same PDB: d3o9wa1, d3o9wa2, d3o9wb_, d3o9wc1, d3o9wc2, d3o9wd2 automated match to d1lp9f1 complexed with 1o2, nag |
PDB Entry: 3o9w (more details), 2.8 Å
SCOPe Domain Sequences for d3o9wd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9wd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle
Timeline for d3o9wd1: