![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (51 PDB entries) |
![]() | Domain d2gfbj1: 2gfb J:1-119 [20001] Other proteins in same PDB: d2gfba1, d2gfba2, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp2 |
PDB Entry: 2gfb (more details), 3 Å
SCOP Domain Sequences for d2gfbj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbj1 b.1.1.1 (J:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak ttap
Timeline for d2gfbj1:
![]() Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp1, d2gfbp2 |