Lineage for d2gfbj1 (2gfb J:1-119)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287316Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (47 PDB entries)
  8. 287380Domain d2gfbj1: 2gfb J:1-119 [20001]
    Other proteins in same PDB: d2gfba1, d2gfba2, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp2

Details for d2gfbj1

PDB Entry: 2gfb (more details), 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfbj1 b.1.1.1 (J:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
ttap

SCOP Domain Coordinates for d2gfbj1:

Click to download the PDB-style file with coordinates for d2gfbj1.
(The format of our PDB-style files is described here.)

Timeline for d2gfbj1: