SCOPe 2.03: Domain d3o3dd2: 3o3d D:182-275

Lineage for d3o3dd2 (3o3d D:182-275)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (186 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d3o3dd2: 3o3d D:182-275 [200001]
   Other proteins in same PDB: d3o3da1, d3o3db_, d3o3dd1, d3o3de_
   automated match to d1i4fa1
   complexed with gol

Details for d3o3dd2

PDB Entry: 3o3d, 1.7 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the Peptidomimetic ELA-2

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3o3dd2:

Sequence; same for both SEQRES and ATOM records:

>d3o3dd2 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d3o3dd2:

• d3o3dd2 is new in SCOPe 2.03-stable
  
• d3o3dd2 appears in SCOPe 2.04
  
• d3o3dd2 appears in the current release, SCOPe 2.08