Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries) Uniprot P01892 25-298 |
Domain d3o3bd1: 3o3b D:1-181 [199996] Other proteins in same PDB: d3o3ba2, d3o3bb_, d3o3bd2, d3o3be_ automated match to d1i4fa2 complexed with gol |
PDB Entry: 3o3b (more details), 1.9 Å
SCOPe Domain Sequences for d3o3bd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o3bd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d3o3bd1:
View in 3D Domains from other chains: (mouse over for more information) d3o3ba1, d3o3ba2, d3o3bb_, d3o3be_ |