SCOP 1.69: Domain d2gfbh1: 2gfb H:1-119

Lineage for d2gfbh1 (2gfb H:1-119)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)

8. Domain d2gfbh1: 2gfb H:1-119 [19999]
   Other proteins in same PDB: d2gfba1, d2gfba2, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp2

Details for d2gfbh1

PDB Entry: 2gfb, 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbh1:

Sequence; same for both SEQRES and ATOM records:

>d2gfbh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsak
ttap

Timeline for d2gfbh1:

• d2gfbh1 first appeared (with stable ids) in SCOP 1.55
  
• d2gfbh1 appears in SCOP 1.67
  
• d2gfbh1 appears in SCOP 1.71
  
• d2gfbh1 appears in the current release, SCOPe 2.08