SCOPe 2.03: Domain d3npsc2: 3nps C:108-212

Lineage for d3npsc2 (3nps C:108-212)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d3npsc2: 3nps C:108-212 [199959]
   Other proteins in same PDB: d3npsa_, d3npsc1
   automated match to d3fcta2
   complexed with cl, edo, na

Details for d3npsc2

PDB Entry: 3nps, 1.5 Å

PDB Description: crystal structure of membrane-type serine protease 1 (mt-sp1) in complex with the fab inhibitor s4

PDB Compounds: (C:) s4 fab light chain

SCOPe Domain Sequences for d3npsc2:

Sequence; same for both SEQRES and ATOM records:

>d3npsc2 b.1.1.2 (C:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d3npsc2:

• d3npsc2 is new in SCOPe 2.03-stable
  
• d3npsc2 appears in SCOPe 2.04
  
• d3npsc2 appears in the current release, SCOPe 2.08