SCOPe 2.07: Domain d3npsc1: 3nps C:3-106A

Lineage for d3npsc1 (3nps C:3-106A)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3npsc1: 3nps C:3-106A [199958]
   Other proteins in same PDB: d3npsa_, d3npsc2
   automated match to d3fcta1
   complexed with cl, edo, na

Details for d3npsc1

PDB Entry: 3nps, 1.5 Å

PDB Description: crystal structure of membrane-type serine protease 1 (mt-sp1) in complex with the fab inhibitor s4

PDB Compounds: (C:) s4 fab light chain

SCOPe Domain Sequences for d3npsc1:

Sequence; same for both SEQRES and ATOM records:

>d3npsc1 b.1.1.0 (C:3-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsgapgqrvtiscsgsssnigsnyvswyqqkpgtapklliydnnqrpsgvpdr
fsgsksgtsavlaitglqsedeadyycqsrdisqyvfgggtkltvl

Timeline for d3npsc1:

• d3npsc1 first appeared in SCOPe 2.03
  
• d3npsc1 appears in SCOPe 2.06
  
• d3npsc1 appears in the current release, SCOPe 2.08