Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d3nigl1: 3nig L:1-107 [199955] Other proteins in same PDB: d3niga_, d3nigc_, d3nigf2, d3nigl2 automated match to d1dqdl1 complexed with ca, gol, mg, nag, so4 |
PDB Entry: 3nig (more details), 2.25 Å
SCOPe Domain Sequences for d3nigl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nigl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik
Timeline for d3nigl1:
View in 3D Domains from other chains: (mouse over for more information) d3niga_, d3nigc_, d3nigf1, d3nigf2 |